Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)

J Michael Conlon (1) , Douglas Woodhams , Haider Raza (2) , Laurent Coquet (3) , Jérôme Leprince (4, 5, 6) , Thierry Jouenne (3) , Hubert Vaudry (4) , Louise Rollins-Smith , J. Michael Conlon

1 Faculty of Medicine and Health Science
2 University of Ulster
3 PBM - Polymères, biopolymères, membranes
4 Neuroendocrinologie cellulaire et moléculaire
5 DC2N - Différenciation et communication neuronale et neuroendocrine
6 DC2N - Différenciation et communication neuronale et neuroendocrine

Two peptides with differential cytolytic activity against bacteria, a fungus pathogenic to amphibians, and mammalian cells were isolated from norepinephrine-stimulated skin secretions of the Lemur leaf frog Hylomantis lemur Boulenger, 1882. Dermaseptin-L1 (GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS) was active against the Gram-negative bacterium Escherichia coli (MIC=8 microM) but inactive against the Gram-positive bacterium Staphylococcus aureus. This peptide inhibited growth of zoospores of the chytrid fungus Batrachochytrium dendrobatidis at concentrations above 25 microM but did not completely inhibit growth at 100 microM. Phylloseptin-L1 (LLGMIPLAISAISALSKL.NH2) was active against S. aureus (MIC=8 microM) but was inactive against E. coli. This peptide also inhibited growth of B. dendrobatidis zoospores at concentrations above 25 microM with complete inhibition at 100 microM. Dermaseptin-L1 showed selective cytolytic activity against HepG2 human hepatoma-derived cells (LC50=45 microM) compared with human erythrocytes (LC50=200 microM) whereas phylloseptin-L1 was approximately equipotent against both HepG2 cells (LC50=35 microM) and erythrocytes (LC50=40 microM).

Domaines: Chimie thérapeutique; Interactions cellulaires [q-bio.CB]; Neurobiologie; Pharmacologie

J Michael Conlon, Douglas Woodhams, Haider Raza, Laurent Coquet, Jérôme Leprince, et al.. Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae). Toxicon, 2007, 50 (4), pp.498-506. ⟨10.1016/j.toxicon.2007.04.017⟩. ⟨hal-01960901⟩